General Information

  • ID:  hor007202
  • Uniprot ID:  Q7KUD5
  • Protein name:  Probable insulin-like peptide 5
  • Gene name:  Insl6
  • Organism:  Drosophila melanogaster
  • Family:  Insulin family
  • Source:  Human
  • Expression:  Expressed at a high level in seven cells of each larval brain hemisphere that may correspond to neurosecretory cells. Expressed at a moderate level in the larval gut.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Protostomia; Ecdysozoa; Panarthropoda; Arthropoda; Mandibulata; Pancrustacea; Hexapoda; Insecta; Dicondylia; Pterygota (winged insects); Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Eremoneura; Cyclorrhapha; Schizophora; Acalyptratae; Ephydroidea; Drosophilidae (pomace flies); Drosophilinae; Drosophilini; Drosophila (fruit flies); Sophophora; melanogaster group; melanogaster subgroup; Drosophila melanogaster (Fruit fly)
  • GO MF:  GO:0005576 extracellular region; GO:0005615 extracellular space
  • GO BP:  GO:0005179 hormone activity; GO:0005158 insulin receptor binding; GO:0048018 receptor ligand activity
  • GO CC:  GO:0008286 insulin receptor signaling pathway; GO:0060180 female mating behavior; GO:0030431 sleep; GO:0007626 locomotory behavior; GO:0033500 carbohydrate homeostasis; GO:0061964 negative regulation of entry into reproductive diapause

Sequence Information

  • Sequence:  NSLRACGPALMDMLRVACPNGFNSMFAKRGTLGLFDYEDHLADLDSSESHHMNSLSSIRRDFRGVVDSCCRKSCSFSTLRAYCDS
  • Length:  85
  • Propeptide:  MMFRSVIPVLLFLIPLLLSAQAANSLRACGPALMDMLRVACPNGFNSMFAKRGTLGLFDYEDHLADLDSSESHHMNSLSSIRRDFRGVVDSCCRKSCSFSTLRAYCDS
  • Signal peptide:  MDVTRLLLATLLVCLCFFTASS
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    NA

Physical Information

Mass: Formula:
Absent amino acids: Common amino acids:
pI: Basic residues:
Polar residues: Hydrophobic residues:
Hydrophobicity: Boman Index:
Half-Life: Half-Life Yeast:
Half-Life E.Coli: Aliphatic Index
Instability Index: Extinction Coefficient cystines:
Absorbance 280nm:

Literature

  • PubMed ID:  NA
  • Title:  NA